PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA018779-PA
Common NameOsI_18523
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 155aa    MW: 16790.8 Da    PI: 9.7386
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA018779-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.69.9e-203064135
              GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                      C+ Cg+t+Tp+WR gp g+++LCnaCG++yrkk++
  BGIOSGA018779-PA 30 CVECGATTTPMWRGGPTGPRSLCNACGIRYRKKRR 64
                      ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.9E-162474IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.732460IPR000679Zinc finger, GATA-type
SuperFamilySSF577167.6E-142667No hitNo description
Gene3DG3DSA:3.30.50.102.9E-152865IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS0034403055IPR000679Zinc finger, GATA-type
PfamPF003201.8E-173064IPR000679Zinc finger, GATA-type
CDDcd002022.27E-123065No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MGSSDQKVIG IAAAAAAAAA AAEEAGRRCC VECGATTTPM WRGGPTGPRS LCNACGIRYR  60
KKRRQELGLD KKQQQEHHPH HHQQQQQQYQ RQQQQQQQED HSDAASSVKD SSSSSSNKSS  120
SLQVVKKRRV LMGVEEAAIL LMALSSSSSP TLLHG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.78340.0leaf| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976038720.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377510.0CT837751.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA108M06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655008.19e-61PREDICTED: GATA transcription factor 23-like
RefseqXP_015692844.19e-61PREDICTED: GATA transcription factor 23-like
TrEMBLB8AY761e-110B8AY76_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA018779-PA1e-109(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67212854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.19e-20GATA transcription factor 23